SYT11 Antibody (2M4R9)

Western Blot: SYT11 Antibody (2M4R9) [NBP3-33397] - Western blot analysis of various lysates, using SYT11(SYT11) Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 2M4R9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SYT11 Antibody (2M4R9) Summary

• Description: Novus Biologicals Rabbit SYT11 Antibody (2M4R9) (NBP3-33397) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (SYT11). (NP_689493.3).
  
  Sequence:
  WSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKM
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SYT11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SYT11 Antibody (2M4R9)

• DKFZp781D015
• KIAA0080synaptotagmin 12
• MGC10881
• MGC17226
• synaptotagmin XISYT12
• synaptotagmin-11
• sytXI

Background

SYT11 may be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT11