Syntenin 1 Antibody (2C12) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Syntenin 1 Primary Antibodies

Order Details


    • Catalog Number
      H00006386-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Syntenin 1 Antibody (2C12) [PerCP] Summary

Immunogen
SDCBP (NP_005616, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
Localization
Cell junction, focal adhesion; Peripheral membrane protein. Cell junction, adherens junction; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein. Nucleus. Melanosome. Note=Mainly membrane-associated. Localized to adhe
Specificity
SDCBP - syndecan binding protein (syntenin)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SDCBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntenin 1 Antibody (2C12) [PerCP]

  • MDA9
  • MDA-9
  • melanoma differentiation associated protein-9
  • Melanoma differentiation-associated protein 9
  • Pro-TGF-alpha cytoplasmic domain-interacting protein 18
  • Scaffold protein Pbp1
  • ST1
  • SYCLTACIP18
  • syndecan binding protein (syntenin)
  • Syndecan-binding protein 1
  • syntenin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5828
Species: Hu
Applications: WB, ICC, Neut
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
NBP1-77148
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-835
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF2560
Species: Hu
Applications: WB
NBP1-84771
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
H00006386-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Syntenin 1 Antibody (H00006386-M01PCP) (0)

There are no publications for Syntenin 1 Antibody (H00006386-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntenin 1 Antibody (H00006386-M01PCP) (0)

There are no reviews for Syntenin 1 Antibody (H00006386-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntenin 1 Antibody (H00006386-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntenin 1 Products

Bioinformatics Tool for Syntenin 1 Antibody (H00006386-M01PCP)

Discover related pathways, diseases and genes to Syntenin 1 Antibody (H00006386-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntenin 1 Antibody (H00006386-M01PCP)

Discover more about diseases related to Syntenin 1 Antibody (H00006386-M01PCP).
 

Pathways for Syntenin 1 Antibody (H00006386-M01PCP)

View related products by pathway.

PTMs for Syntenin 1 Antibody (H00006386-M01PCP)

Learn more about PTMs related to Syntenin 1 Antibody (H00006386-M01PCP).

Blogs on Syntenin 1

There are no specific blogs for Syntenin 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntenin 1 Antibody (2C12) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SDCBP