Syntaxin 4 Antibody (6D1) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related Syntaxin 4 Primary Antibodies

Order Details


    • Catalog Number
      H00006810-M04FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Syntaxin 4 Antibody (6D1) [DyLight 680] Summary

Immunogen
STX4A (NP_004595, 19 a.a. - 119 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Specificity
STX4A (6D1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin 4 Antibody (6D1) [DyLight 680]

  • NY-REN-31
  • p35-2
  • Renal carcinoma antigen NY-REN-31
  • STX4
  • STX4Ap35-2
  • Syntaxin 4
  • syntaxin 4A (placental)
  • syntaxin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5659
Species: Hu
Applications: WB
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
AF5354
Species: Hu
Applications: WB, IHC
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB2568
Species: Mu
Applications: WB, IHC
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4828
Species: Hu, Mu
Applications: WB, IHC
AF6386
Species: Hu
Applications: WB, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for Syntaxin 4 Antibody (H00006810-M04FR) (0)

There are no publications for Syntaxin 4 Antibody (H00006810-M04FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 4 Antibody (H00006810-M04FR) (0)

There are no reviews for Syntaxin 4 Antibody (H00006810-M04FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 4 Antibody (H00006810-M04FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 4 Products

Bioinformatics Tool for Syntaxin 4 Antibody (H00006810-M04FR)

Discover related pathways, diseases and genes to Syntaxin 4 Antibody (H00006810-M04FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 4 Antibody (H00006810-M04FR)

Discover more about diseases related to Syntaxin 4 Antibody (H00006810-M04FR).
 

Pathways for Syntaxin 4 Antibody (H00006810-M04FR)

View related products by pathway.

Blogs on Syntaxin 4

There are no specific blogs for Syntaxin 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 4 Antibody (6D1) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol STX4
Entrez