Syntaxin 1A Antibody

Images

 
Western Blot: Syntaxin 1A Antibody [H00006804-D01P] - Analysis of STX1A expression in rat brain.
Western Blot: Syntaxin 1A Antibody [H00006804-D01P] - Analysis of STX1A expression in mouse liver.
Western Blot: Syntaxin 1A Antibody [H00006804-D01P] - Analysis of STX1A expression in transfected 293T cell line by STX1A polyclonal antibody.Lane 1: STX1A transfected lysate(29.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin 1A Antibody Summary

Immunogen
STX1A (AAH03011.1, 1 a.a. - 251 a.a.) full-length human protein. MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Specificity
STX1A - syntaxin 1A (brain),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX1A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin 1A Antibody

  • Brain Syntaxin
  • HPC-1
  • Neuron-specific antigen HPC-1
  • p35-1
  • STX1A
  • STX1P35-1
  • SYN1A
  • syntaxin 1A (brain)
  • Syntaxin 1A
  • syntaxin-1A

Background

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2568
Species: Mu
Applications: WB, IHC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6848
Species: Hu, Mu, Rt
Applications: WB
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC

Publications for Syntaxin 1A Antibody (H00006804-D01P) (0)

There are no publications for Syntaxin 1A Antibody (H00006804-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 1A Antibody (H00006804-D01P) (0)

There are no reviews for Syntaxin 1A Antibody (H00006804-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntaxin 1A Antibody (H00006804-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 1A Products

Bioinformatics Tool for Syntaxin 1A Antibody (H00006804-D01P)

Discover related pathways, diseases and genes to Syntaxin 1A Antibody (H00006804-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 1A Antibody (H00006804-D01P)

Discover more about diseases related to Syntaxin 1A Antibody (H00006804-D01P).
 

Pathways for Syntaxin 1A Antibody (H00006804-D01P)

View related products by pathway.

PTMs for Syntaxin 1A Antibody (H00006804-D01P)

Learn more about PTMs related to Syntaxin 1A Antibody (H00006804-D01P).
 

Research Areas for Syntaxin 1A Antibody (H00006804-D01P)

Find related products by research area.

Blogs on Syntaxin 1A

There are no specific blogs for Syntaxin 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX1A
Entrez
Uniprot