Syntaxin 1A Antibody (1B11-1A8) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Syntaxin 1A Primary Antibodies

Order Details


    • Catalog Number
      H00006804-M02V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Syntaxin 1A Antibody (1B11-1A8) [DyLight 405] Summary

Immunogen
STX1A (AAH03011.1, 1 a.a. - 251 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Specificity
STX1A - syntaxin 1A (brain)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STX1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin 1A Antibody (1B11-1A8) [DyLight 405]

  • Brain Syntaxin
  • HPC-1
  • Neuron-specific antigen HPC-1
  • p35-1
  • STX1A
  • STX1P35-1
  • SYN1A
  • syntaxin 1A (brain)
  • Syntaxin 1A
  • syntaxin-1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2568
Species: Mu
Applications: WB, IHC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4999
Species: Mu
Applications: WB, Simple Western
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6848
Species: Hu, Mu, Rt
Applications: WB
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-511
Species: Hu, Mu, Rt, Ch
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
H00006804-M02V
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Syntaxin 1A Antibody (H00006804-M02V) (0)

There are no publications for Syntaxin 1A Antibody (H00006804-M02V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 1A Antibody (H00006804-M02V) (0)

There are no reviews for Syntaxin 1A Antibody (H00006804-M02V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 1A Antibody (H00006804-M02V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 1A Products

Related Products by Gene

Bioinformatics Tool for Syntaxin 1A Antibody (H00006804-M02V)

Discover related pathways, diseases and genes to Syntaxin 1A Antibody (H00006804-M02V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 1A Antibody (H00006804-M02V)

Discover more about diseases related to Syntaxin 1A Antibody (H00006804-M02V).
 

Pathways for Syntaxin 1A Antibody (H00006804-M02V)

View related products by pathway.

PTMs for Syntaxin 1A Antibody (H00006804-M02V)

Learn more about PTMs related to Syntaxin 1A Antibody (H00006804-M02V).
 

Research Areas for Syntaxin 1A Antibody (H00006804-M02V)

Find related products by research area.

Blogs on Syntaxin 1A

There are no specific blogs for Syntaxin 1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 1A Antibody (1B11-1A8) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol STX1A
Entrez
Uniprot