Synphilin-1 Antibody (2A8)

Images

 
Sandwich ELISA: Synphilin-1 Antibody (2A8) [H00009627-M01] - Detection limit for recombinant GST tagged SNCAIP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Synphilin-1 Antibody (2A8) Summary

Immunogen
SNCAIP (NP_005451, 206 a.a. ~ 310 a.a) partial recombinant protein with GST tag.PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGS AYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSA AESKPEEQVSGLNRTSSQGP
Localization
Cytoplasmic
Specificity
SNCAIP - synuclein, alpha interacting protein (synphilin)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNCAIP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synphilin-1 Antibody (2A8)

  • Alpha-synuclein-interacting protein
  • MGC39814
  • Sph1
  • synphilin-1
  • synuclein, alpha interacting protein
  • SYPH1

Background

This gene encodes a protein containing several protein-protein interaction domains, including ankyrin-like repeats, a coiled-coil domain, and an ATP/GTP-binding motif. The encoded protein interacts with alpha-synuclein in neuronal tissue and may play a role in the formation of cytoplasmic inclusions and neurodegeneration. A mutation in this gene has been associated with Parkinson's disease. Alternatively spliced transcript variants encoding different isoforms of this gene have been described, but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87989
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00009627-M01
Species: Hu
Applications: WB, ELISA

Publications for Synphilin-1 Antibody (H00009627-M01) (0)

There are no publications for Synphilin-1 Antibody (H00009627-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synphilin-1 Antibody (H00009627-M01) (0)

There are no reviews for Synphilin-1 Antibody (H00009627-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synphilin-1 Antibody (H00009627-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synphilin-1 Products

Bioinformatics Tool for Synphilin-1 Antibody (H00009627-M01)

Discover related pathways, diseases and genes to Synphilin-1 Antibody (H00009627-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synphilin-1 Antibody (H00009627-M01)

Discover more about diseases related to Synphilin-1 Antibody (H00009627-M01).
 

Pathways for Synphilin-1 Antibody (H00009627-M01)

View related products by pathway.

PTMs for Synphilin-1 Antibody (H00009627-M01)

Learn more about PTMs related to Synphilin-1 Antibody (H00009627-M01).
 

Research Areas for Synphilin-1 Antibody (H00009627-M01)

Find related products by research area.

Blogs on Synphilin-1

There are no specific blogs for Synphilin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synphilin-1 Antibody (2A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNCAIP
Entrez
OMIM
Uniprot