Synaptotagmin 4 Antibody (5F8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Synaptotagmin 4 Primary Antibodies

Order Details


    • Catalog Number
      H00006860-M04G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Synaptotagmin 4 Antibody (5F8) [DyLight 488] Summary

Immunogen
SYT4 (NP_065834, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR
Specificity
SYT4 (5F8)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SYT4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synaptotagmin 4 Antibody (5F8) [DyLight 488]

  • HsT1192
  • KIAA1342sytIV
  • synaptotagmin 4
  • synaptotagmin IVsynaptotagmin-4
  • SytIV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-19320
Species: Mu, Rt, Fi, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-13568
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81628
Species: Hu
Applications: WB, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-81588
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Synaptotagmin 4 Antibody (H00006860-M04G) (0)

There are no publications for Synaptotagmin 4 Antibody (H00006860-M04G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 4 Antibody (H00006860-M04G) (0)

There are no reviews for Synaptotagmin 4 Antibody (H00006860-M04G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptotagmin 4 Antibody (H00006860-M04G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptotagmin 4 Products

Bioinformatics Tool for Synaptotagmin 4 Antibody (H00006860-M04G)

Discover related pathways, diseases and genes to Synaptotagmin 4 Antibody (H00006860-M04G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 4 Antibody (H00006860-M04G)

Discover more about diseases related to Synaptotagmin 4 Antibody (H00006860-M04G).
 

Pathways for Synaptotagmin 4 Antibody (H00006860-M04G)

View related products by pathway.

PTMs for Synaptotagmin 4 Antibody (H00006860-M04G)

Learn more about PTMs related to Synaptotagmin 4 Antibody (H00006860-M04G).
 

Research Areas for Synaptotagmin 4 Antibody (H00006860-M04G)

Find related products by research area.

Blogs on Synaptotagmin 4

There are no specific blogs for Synaptotagmin 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptotagmin 4 Antibody (5F8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT4