Synaptoporin Antibody

Images

 
Western Blot: Synaptoporin Antibody [NBP1-69191] - Mouse Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Synaptoporin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69191
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Synaptoporin Antibody Summary

Immunogen
Synthetic peptides corresponding to Synpr (synaptoporin) The peptide sequence was selected from the middle region of Synpr. Peptide sequence LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV.
Clonality
Polyclonal
Host
Rabbit
Gene
SYNPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Synpr and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Synaptoporin Antibody

  • DKFZp686G0883
  • MGC26651
  • SPO
  • synaptoporin

Background

Synpr is the intrinsic membrane protein of small synaptic vesicles. Synpr is a probable vesicular channel protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-61572
Species: Hu, Bv, Pm
Applications: WB
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-76316
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF7250
Species: Hu
Applications: IHC

Publications for Synaptoporin Antibody (NBP1-69191) (0)

There are no publications for Synaptoporin Antibody (NBP1-69191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptoporin Antibody (NBP1-69191) (0)

There are no reviews for Synaptoporin Antibody (NBP1-69191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptoporin Antibody (NBP1-69191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptoporin Products

Bioinformatics Tool for Synaptoporin Antibody (NBP1-69191)

Discover related pathways, diseases and genes to Synaptoporin Antibody (NBP1-69191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptoporin Antibody (NBP1-69191)

Discover more about diseases related to Synaptoporin Antibody (NBP1-69191).
 

Pathways for Synaptoporin Antibody (NBP1-69191)

View related products by pathway.

PTMs for Synaptoporin Antibody (NBP1-69191)

Learn more about PTMs related to Synaptoporin Antibody (NBP1-69191).

Blogs on Synaptoporin

There are no specific blogs for Synaptoporin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptoporin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNPR
Uniprot