Symplekin Antibody

Images

 
Western Blot: Symplekin Antibody [NBP1-59104] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Symplekin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59104
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Symplekin Antibody Summary

Immunogen
Synthetic peptides corresponding to SYMPK(symplekin) The peptide sequence was selected from the middle region of SYMPK. Peptide sequence GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS.
Clonality
Polyclonal
Host
Rabbit
Gene
SYMPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SYMPK and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Symplekin Antibody

  • FLJ27092
  • SPKSYM
  • symplekin

Background

SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00171558-R02
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49214
Species: Hu
Applications: IHC
NBP1-85010
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP2-32350
Species: Hu
Applications: WB, IHC
NBP1-31231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59104
Species: Hu
Applications: WB

Publications for Symplekin Antibody (NBP1-59104) (0)

There are no publications for Symplekin Antibody (NBP1-59104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Symplekin Antibody (NBP1-59104) (0)

There are no reviews for Symplekin Antibody (NBP1-59104). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Symplekin Antibody (NBP1-59104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Symplekin Antibody Products

Related Products by Gene

Bioinformatics Tool for Symplekin Antibody (NBP1-59104)

Discover related pathways, diseases and genes to Symplekin Antibody (NBP1-59104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Symplekin Antibody (NBP1-59104)

Discover more about diseases related to Symplekin Antibody (NBP1-59104).
 

Pathways for Symplekin Antibody (NBP1-59104)

View related products by pathway.

PTMs for Symplekin Antibody (NBP1-59104)

Learn more about PTMs related to Symplekin Antibody (NBP1-59104).

Blogs on Symplekin

There are no specific blogs for Symplekin, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SYMPK
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59104 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.