Symplekin Antibody (NBP1-59104)

Images

 
Western Blot: Symplekin Antibody [NBP1-59104] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Symplekin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59104
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Symplekin Antibody Summary

Immunogen
Synthetic peptides corresponding to SYMPK(symplekin) The peptide sequence was selected from the middle region of SYMPK. Peptide sequence GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS.
Clonality
Polyclonal
Host
Rabbit
Gene
SYMPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SYMPK and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Symplekin Antibody

  • FLJ27092
  • SPKSYM
  • symplekin

Background

SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF2460
Species: Hu
Applications: WB, IP, Neut
H00171558-R02
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Symplekin Antibody (NBP1-59104) (0)

There are no publications for Symplekin Antibody (NBP1-59104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Symplekin Antibody (NBP1-59104) (0)

There are no reviews for Symplekin Antibody (NBP1-59104). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Symplekin Antibody (NBP1-59104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Symplekin Products

Related Products by Gene

Bioinformatics Tool for Symplekin Antibody (NBP1-59104)

Discover related pathways, diseases and genes to Symplekin Antibody (NBP1-59104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Symplekin Antibody (NBP1-59104)

Discover more about diseases related to Symplekin Antibody (NBP1-59104).
 

Pathways for Symplekin Antibody (NBP1-59104)

View related products by pathway.

PTMs for Symplekin Antibody (NBP1-59104)

Learn more about PTMs related to Symplekin Antibody (NBP1-59104).

Blogs on Symplekin

There are no specific blogs for Symplekin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Symplekin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYMPK
Uniprot