Symplekin Antibody (4C2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Symplekin Primary Antibodies

Order Details


    • Catalog Number
      H00008189-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Symplekin Antibody (4C2) [PE] Summary

Immunogen
SYMPK (AAH30214, 1 a.a. - 533 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPR
Localization
Cytoplasm, cytoskeleton. Cell junction, adherens junction; Cytoplasmic side. Cell junction; Cytoplasmic side. Nucleus, nucleoplasm. Note=Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without
Specificity
SYMPK - symplekin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SYMPK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Symplekin Antibody (4C2) [PE]

  • FLJ27092
  • SPKSYM
  • symplekin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-05680
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008189-M03PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Symplekin Antibody (H00008189-M03PE) (0)

There are no publications for Symplekin Antibody (H00008189-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Symplekin Antibody (H00008189-M03PE) (0)

There are no reviews for Symplekin Antibody (H00008189-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Symplekin Antibody (H00008189-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Symplekin Products

Bioinformatics Tool for Symplekin Antibody (H00008189-M03PE)

Discover related pathways, diseases and genes to Symplekin Antibody (H00008189-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Symplekin Antibody (H00008189-M03PE)

Discover more about diseases related to Symplekin Antibody (H00008189-M03PE).
 

Pathways for Symplekin Antibody (H00008189-M03PE)

View related products by pathway.

PTMs for Symplekin Antibody (H00008189-M03PE)

Learn more about PTMs related to Symplekin Antibody (H00008189-M03PE).

Blogs on Symplekin

There are no specific blogs for Symplekin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Symplekin Antibody (4C2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SYMPK