SWAP70 Antibody

Images

 
Western Blot: SWAP70 Antibody [NBP1-52961] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SWAP70 Antibody Summary

Immunogen
Synthetic peptides corresponding to SWAP70(SWAP-70 protein) The peptide sequence was selected from the N terminal of SWAP70. Peptide sequence ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SWAP70
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SWAP70 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SWAP70 Antibody

  • KIAA0640SWAP-70FLJ39540
  • SWAP switching B-cell complex 70kDa subunit
  • SWAP70
  • switch-associated protein 70

Background

Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46456
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001671-M01
Species: Hu
Applications: WB, ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-71833
Species: Hu, Mu
Applications: WB
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
594-ML/CF
Species: Mu

Publications for SWAP70 Antibody (NBP1-52961) (0)

There are no publications for SWAP70 Antibody (NBP1-52961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SWAP70 Antibody (NBP1-52961) (0)

There are no reviews for SWAP70 Antibody (NBP1-52961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SWAP70 Antibody (NBP1-52961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SWAP70 Products

Bioinformatics Tool for SWAP70 Antibody (NBP1-52961)

Discover related pathways, diseases and genes to SWAP70 Antibody (NBP1-52961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SWAP70 Antibody (NBP1-52961)

Discover more about diseases related to SWAP70 Antibody (NBP1-52961).
 

Pathways for SWAP70 Antibody (NBP1-52961)

View related products by pathway.

PTMs for SWAP70 Antibody (NBP1-52961)

Learn more about PTMs related to SWAP70 Antibody (NBP1-52961).

Blogs on SWAP70

There are no specific blogs for SWAP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SWAP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SWAP70
Entrez
Uniprot