Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SUSD5. Peptide sequence: PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SUSD5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SUSD5 Antibody (NBP2-85847)Discover more about diseases related to SUSD5 Antibody (NBP2-85847).
| Pathways for SUSD5 Antibody (NBP2-85847)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SUSD5 |