Supervillin Antibody (6E10.) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related Supervillin Primary Antibodies

Order Details


    • Catalog Number
      H00006840-M03IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Supervillin Antibody (6E10.) [DyLight 755] Summary

Immunogen
SVIL (NP_003165 1679 a.a. - 1786 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG
Specificity
SVIL - supervillin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SVIL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Supervillin Antibody (6E10.) [DyLight 755]

  • Archvillin
  • DKFZp686A17191
  • membrane-associated F-actin binding protein p205
  • p205/p250
  • Supervillin
  • SVIL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89021
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5626
Species: Hu
Applications: WB, ICC
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Supervillin Antibody (H00006840-M03IR) (0)

There are no publications for Supervillin Antibody (H00006840-M03IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Supervillin Antibody (H00006840-M03IR) (0)

There are no reviews for Supervillin Antibody (H00006840-M03IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Supervillin Antibody (H00006840-M03IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Supervillin Products

Bioinformatics Tool for Supervillin Antibody (H00006840-M03IR)

Discover related pathways, diseases and genes to Supervillin Antibody (H00006840-M03IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Supervillin Antibody (H00006840-M03IR)

Discover more about diseases related to Supervillin Antibody (H00006840-M03IR).
 

Pathways for Supervillin Antibody (H00006840-M03IR)

View related products by pathway.

PTMs for Supervillin Antibody (H00006840-M03IR)

Learn more about PTMs related to Supervillin Antibody (H00006840-M03IR).

Blogs on Supervillin

There are no specific blogs for Supervillin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Supervillin Antibody (6E10.) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol SVIL
Entrez