SUN1 Antibody


Western Blot: SUN1 Antibody [NBP1-59354] - Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/ml.
Immunohistochemistry: SUN1 Antibody [NBP1-59354] - SampleType : Mouse C2C12 cells Dilution : 1: 500 Secondary Antibody : Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution : 1: 500 Color/Signal Descriptions : more
Western Blot: SUN1 Antibody [NBP1-59354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SUN1 Antibody [NBP1-59354] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SUN1 Antibody [NBP1-59354] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related SUN1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SUN1 Antibody Summary

Synthetic peptides corresponding to UNC84A(unc-84 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of UNC84A. Peptide sequence QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against UNC84A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SUN1 Antibody

  • KIAA0810UNC84AFLJ12407
  • MGC176649
  • Protein unc-84 homolog A
  • Sad1 and UNC84 domain containing 1
  • Sad1 unc-84 domain protein 1
  • Sad1/unc-84 protein-like 1
  • SUN domain-containing protein 1
  • unc-84 homolog A (C. elegans)
  • unc-84 homolog A


UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUN1 Antibody (NBP1-59354) (0)

There are no publications for SUN1 Antibody (NBP1-59354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUN1 Antibody (NBP1-59354) (0)

There are no reviews for SUN1 Antibody (NBP1-59354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUN1 Antibody (NBP1-59354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SUN1 Products

Bioinformatics Tool for SUN1 Antibody (NBP1-59354)

Discover related pathways, diseases and genes to SUN1 Antibody (NBP1-59354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUN1 Antibody (NBP1-59354)

Discover more about diseases related to SUN1 Antibody (NBP1-59354).

Pathways for SUN1 Antibody (NBP1-59354)

View related products by pathway.

PTMs for SUN1 Antibody (NBP1-59354)

Learn more about PTMs related to SUN1 Antibody (NBP1-59354).

Blogs on SUN1

There are no specific blogs for SUN1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SUN1 Antibody and receive a gift card or discount.


Gene Symbol SUN1