SUN1 Antibody

Images

 
Western Blot: SUN1 Antibody [NBP1-59354] - Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/ml.
Immunohistochemistry: SUN1 Antibody [NBP1-59354] - SampleType : Mouse C2C12 cells Dilution : 1: 500 Secondary Antibody : Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution : 1: 500 Color/Signal Descriptions : ...read more
Western Blot: SUN1 Antibody [NBP1-59354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SUN1 Antibody [NBP1-59354] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SUN1 Antibody [NBP1-59354] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related SUN1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59354
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SUN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to UNC84A(unc-84 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of UNC84A. Peptide sequence QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA.
Clonality
Polyclonal
Host
Rabbit
Gene
SUN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against UNC84A and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SUN1 Antibody

  • KIAA0810UNC84AFLJ12407
  • MGC176649
  • Protein unc-84 homolog A
  • Sad1 and UNC84 domain containing 1
  • Sad1 unc-84 domain protein 1
  • Sad1/unc-84 protein-like 1
  • SUN domain-containing protein 1
  • unc-84 homolog A (C. elegans)
  • unc-84 homolog A

Background

UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58289
Species: Hu
Applications: WB
NBP1-84190
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-49175
Species: Hu
Applications: WB, IHC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-20685
Species: Hu
Applications: WB
AF3155
Species: Mu
Applications: WB, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59354
Species: Hu
Applications: WB, IHC

Publications for SUN1 Antibody (NBP1-59354) (0)

There are no publications for SUN1 Antibody (NBP1-59354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUN1 Antibody (NBP1-59354) (0)

There are no reviews for SUN1 Antibody (NBP1-59354). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUN1 Antibody (NBP1-59354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUN1 Antibody Products

Related Products by Gene

Bioinformatics Tool for SUN1 Antibody (NBP1-59354)

Discover related pathways, diseases and genes to SUN1 Antibody (NBP1-59354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUN1 Antibody (NBP1-59354)

Discover more about diseases related to SUN1 Antibody (NBP1-59354).
 

Pathways for SUN1 Antibody (NBP1-59354)

View related products by pathway.

PTMs for SUN1 Antibody (NBP1-59354)

Learn more about PTMs related to SUN1 Antibody (NBP1-59354).

Blogs on SUN1

There are no specific blogs for SUN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SUN1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59354 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.