SUN1 Antibody

Images

 
Western Blot: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2945 Dilution: 1:1000
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977 Dilution: 1:1000 Affinity purified
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2977. Wild type gonad Affinity purified, dilution: 1:1000
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [41970002] - This image is specific to animal number SDQ2945 Dilution: 1:10000

Product Details

Summary
Reactivity CeSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

SUN1 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
DGTHHNSEGSYADKDANWASEKQKFHQTISNLRAEFSAHDKQLDFKTDHLEKLLENVLEHSKGWKESAIEELKQIKLWQAEISDALQQMKKEIDDAKSTK
Specificity
Caenorhabditis elegans SUN1
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA, Western Blot, and Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals.

Alternate Names for SUN1 Antibody

  • KIAA0810UNC84AFLJ12407
  • MGC176649
  • Protein unc-84 homolog A
  • Sad1 and UNC84 domain containing 1
  • Sad1 unc-84 domain protein 1
  • Sad1/unc-84 protein-like 1
  • SUN domain-containing protein 1
  • unc-84 homolog A (C. elegans)
  • unc-84 homolog A

Background

This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-49175
Species: Hu
Applications: WB, IHC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
AF3155
Species: Mu
Applications: WB, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Supplier Logo

Publications for SUN1 Antibody (41970002) (0)

There are no publications for SUN1 Antibody (41970002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUN1 Antibody (41970002) (0)

There are no reviews for SUN1 Antibody (41970002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUN1 Antibody (41970002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUN1 Products

Bioinformatics Tool for SUN1 Antibody (41970002)

Discover related pathways, diseases and genes to SUN1 Antibody (41970002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUN1 Antibody (41970002)

Discover more about diseases related to SUN1 Antibody (41970002).
 

Pathways for SUN1 Antibody (41970002)

View related products by pathway.

PTMs for SUN1 Antibody (41970002)

Learn more about PTMs related to SUN1 Antibody (41970002).
 

Research Areas for SUN1 Antibody (41970002)

Find related products by research area.

Blogs on SUN1

There are no specific blogs for SUN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUN1
Entrez
Uniprot