SUMO3 Antibody (4B9)

Images

 
Immunocytochemistry/ Immunofluorescence: SUMO3 Antibody (4B9) [H00006612-M07] - Analysis of monoclonal antibody to SUMO3 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SUMO3 Antibody (4B9) Summary

Immunogen
SUMO3 (NP_008867, 1 a.a. - 103 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Specificity
SUMO3 - SMT3 suppressor of mif two 3 homolog 3 (yeast) (4B9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SUMO3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUMO3 Antibody (4B9)

  • SMT3 (suppressor of mif two 3, yeast) homolog 1
  • SMT3 homolog 1
  • SMT3 suppressor of mif two 3 homolog 1
  • SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 3 (yeast)
  • SMT3A
  • SMT3B
  • SMT3H1
  • SMT3H1small ubiquitin-related modifier 3
  • SUMO-2
  • SUMO3
  • SUMO-3
  • ubiquitin-like protein SMT3A
  • Ubiquitin-like protein SMT3B

Background

SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
H00006612-M07
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SUMO3 Antibody (H00006612-M07) (0)

There are no publications for SUMO3 Antibody (H00006612-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO3 Antibody (H00006612-M07) (0)

There are no reviews for SUMO3 Antibody (H00006612-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUMO3 Antibody (H00006612-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUMO3 Products

Bioinformatics Tool for SUMO3 Antibody (H00006612-M07)

Discover related pathways, diseases and genes to SUMO3 Antibody (H00006612-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUMO3 Antibody (H00006612-M07)

Discover more about diseases related to SUMO3 Antibody (H00006612-M07).
 

Pathways for SUMO3 Antibody (H00006612-M07)

View related products by pathway.

PTMs for SUMO3 Antibody (H00006612-M07)

Learn more about PTMs related to SUMO3 Antibody (H00006612-M07).
 

Research Areas for SUMO3 Antibody (H00006612-M07)

Find related products by research area.

Blogs on SUMO3

There are no specific blogs for SUMO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUMO3 Antibody (4B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMO3
Entrez
Uniprot