SUMO2 Antibody

Images

 
Western Blot: SUMO2 Antibody [H00006613-D01P] - Analysis of SUMO2 expression in transfected 293T cell line by SUMO2 polyclonal antibody.Lane 1: SUMO2 transfected lysate(10.90 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SUMO2 Antibody [H00006613-D01P] - Analysis of antibody to SUMO2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUMO2 Antibody Summary

Immunogen
SUMO2 (NP_008868.3, 1 a.a. - 95 a.a.) full-length human protein. MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUMO2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUMO2 Antibody

  • HSMT3
  • MGC117191
  • sentrin 2
  • Sentrin-2
  • small ubiquitin-like modifier 2
  • small ubiquitin-related modifier 2
  • SMT3 (suppressor of mif two 3, yeast) homolog 2
  • SMT3 homolog 2
  • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 2 (yeast)
  • SMT3A
  • SMT3B
  • SMT3H2
  • SUMO2
  • SUMO-2
  • SUMO3
  • SUMO-3
  • Ubiquitin-like protein SMT3A
  • ubiquitin-like protein SMT3B

Background

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-55474
Species: Hu
Applications: ICC/IF
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00006613-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for SUMO2 Antibody (H00006613-D01P) (0)

There are no publications for SUMO2 Antibody (H00006613-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO2 Antibody (H00006613-D01P) (0)

There are no reviews for SUMO2 Antibody (H00006613-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUMO2 Antibody (H00006613-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUMO2 Products

Bioinformatics Tool for SUMO2 Antibody (H00006613-D01P)

Discover related pathways, diseases and genes to SUMO2 Antibody (H00006613-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUMO2 Antibody (H00006613-D01P)

Discover more about diseases related to SUMO2 Antibody (H00006613-D01P).
 

Pathways for SUMO2 Antibody (H00006613-D01P)

View related products by pathway.

PTMs for SUMO2 Antibody (H00006613-D01P)

Learn more about PTMs related to SUMO2 Antibody (H00006613-D01P).

Blogs on SUMO2.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUMO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMO2
Entrez
Uniprot