Recombinant Human SUCNR1/GPR91 Protein

Images

 
There are currently no images for SUCNR1/GPR91 Recombinant Protein (H00056670-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func

Order Details

Recombinant Human SUCNR1/GPR91 Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-334 of Human SUCNR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SUCNR1
Purity
>30% by SDS-PAGE and Coomassie blue staining

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative
Purity
>30% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SUCNR1/GPR91 Protein

  • GPR91
  • GPR91G protein-coupled receptor 91
  • G-protein coupled receptor 91
  • P2Y purinoceptor 1
  • P2Y purinoceptor 1-like
  • succinate receptor 1
  • SUCNR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P, ICC

Publications for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no publications for SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no reviews for SUCNR1/GPR91 Recombinant Protein (H00056670-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUCNR1/GPR91 Products

Bioinformatics Tool for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Discover related pathways, diseases and genes to SUCNR1/GPR91 Recombinant Protein (H00056670-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Discover more about diseases related to SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
 

Pathways for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

View related products by pathway.

PTMs for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Learn more about PTMs related to SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
 

Research Areas for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Find related products by research area.

Blogs on SUCNR1/GPR91.

SUCNR1/GPR91 - a potential role in renovascular hypertension
SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SUCNR1/GPR91 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUCNR1
Entrez