SUCNR1/GPR91 Recombinant Protein

Images

 
There are currently no images for SUCNR1/GPR91 Recombinant Protein (H00056670-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

SUCNR1/GPR91 Recombinant Protein Summary

Description
SUCNR1/GPR91 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Gene
SUCNR1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUCNR1/GPR91 Recombinant Protein

  • GPR91
  • GPR91G protein-coupled receptor 91
  • G-protein coupled receptor 91
  • P2Y purinoceptor 1
  • P2Y purinoceptor 1-like
  • succinate receptor 1
  • SUCNR1/GPR91

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS415
Species: Hu, Mk
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, ICC
NBP1-84903
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, ICC
NLS2576
Species: Hu, Mk
Applications: IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Flow, IHC, ICC
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, TCS, LA
NBP2-33870
Species: Hu
Applications: WB, IHC, IHC-P
MAB3429
Species: Hu
Applications: WB
H00056670-G01
Species: Hu

Publications for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no publications for SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no reviews for SUCNR1/GPR91 Recombinant Protein (H00056670-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for SUCNR1/GPR91 Recombinant Protein (H00056670-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUCNR1/GPR91 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Discover related pathways, diseases and genes to SUCNR1/GPR91 Recombinant Protein (H00056670-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Discover more about diseases related to SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
 

Pathways for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

View related products by pathway.

PTMs for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Learn more about PTMs related to SUCNR1/GPR91 Recombinant Protein (H00056670-G01).
 

Research Areas for SUCNR1/GPR91 Recombinant Protein (H00056670-G01)

Find related products by research area.

Blogs on SUCNR1/GPR91.

SUCNR1/GPR91 - a potential role in renovascular hypertension
SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SUCNR1
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00056670-G01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought