SUCLG1 Antibody

Images

 
Independent Antibodies: Western Blot: SUCLG1 Antibody [NBP1-89489] - Analysis using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar pattern to independent antibody NBP2-38318 (B).
Immunocytochemistry/ Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human colon.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.
Independent Antibodies: Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum, fallopian tube, kidney and stomach using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar ...read more
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUCLG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUCLG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUCLG1 Protein (NBP1-89489PEP)
Publications
Read Publication using
NBP1-89489 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUCLG1 Antibody

  • EC 6.2.1
  • EC 6.2.1.4
  • FLJ21114
  • FLJ43513
  • GALPHA
  • MTDPS9
  • SCS-alpha
  • succinate-CoA ligase, alpha subunit
  • succinate-CoA ligase, GDP-forming, alpha subunit
  • succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
  • Succinyl-CoA synthetase subunit alpha
  • SUCLA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS2576
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
NLS1017
Species: Hu, Mu, Bt, Bv, Ca, Eq
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-94071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUCLG1 Antibody (NBP1-89489)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SUCLG1 Antibody (NBP1-89489) (0)

There are no reviews for SUCLG1 Antibody (NBP1-89489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUCLG1 Antibody (NBP1-89489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUCLG1 Products

Bioinformatics Tool for SUCLG1 Antibody (NBP1-89489)

Discover related pathways, diseases and genes to SUCLG1 Antibody (NBP1-89489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCLG1 Antibody (NBP1-89489)

Discover more about diseases related to SUCLG1 Antibody (NBP1-89489).
 

Pathways for SUCLG1 Antibody (NBP1-89489)

View related products by pathway.

Blogs on SUCLG1

There are no specific blogs for SUCLG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUCLG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUCLG1