Substance P Antibody

Images

 
Western Blot: Substance P Antibody [NBP1-69101] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.

Product Details

Summary
Product Discontinued
View other related Substance P Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69101
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Substance P Antibody Summary

Immunogen
Synthetic peptides corresponding to TAC1 (tachykinin, precursor 1) The peptide sequence was selected from the middle region of TAC1. Peptide sequence MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH.
Clonality
Polyclonal
Host
Rabbit
Gene
TAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TAC1 and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Substance P Antibody

  • neurokinin 1
  • neurokinin 2
  • neurokinin A
  • Neurokinin-1
  • neuromedin L, neurokinin alpha, neuropeptide K, neuropeptide gamma)
  • neuropeptide gamma
  • neuropeptide K
  • NK2
  • NKA
  • NKNAneurokinin alpha
  • NPK
  • PPT
  • protachykinin-1
  • substance K
  • Substance P
  • TAC2neuromedin L
  • tachykinin 2
  • tachykinin, precursor 1 (substance K, substance P, neurokinin 1, neurokinin 2
  • tachykinin, precursor 1

Background

This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4077
Species: Hu
Applications: WB, IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6700
Species: Hu
Applications: Flow, CyTOF-ready
AF1396
Species: Hu
Applications: WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl

Publications for Substance P Antibody (NBP1-69101) (0)

There are no publications for Substance P Antibody (NBP1-69101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Substance P Antibody (NBP1-69101) (0)

There are no reviews for Substance P Antibody (NBP1-69101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Substance P Antibody (NBP1-69101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Substance P Products

Bioinformatics Tool for Substance P Antibody (NBP1-69101)

Discover related pathways, diseases and genes to Substance P Antibody (NBP1-69101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Substance P Antibody (NBP1-69101)

Discover more about diseases related to Substance P Antibody (NBP1-69101).
 

Pathways for Substance P Antibody (NBP1-69101)

View related products by pathway.

PTMs for Substance P Antibody (NBP1-69101)

Learn more about PTMs related to Substance P Antibody (NBP1-69101).
 

Research Areas for Substance P Antibody (NBP1-69101)

Find related products by research area.

Blogs on Substance P

There are no specific blogs for Substance P, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Substance P Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAC1