STYK1 Antibody (3A8)

Images

 
Western Blot: STYK1 Antibody (3A8) [H00055359-M01] - Analysis of STYK1 expression in transfected 293T cell line by STYK1 monoclonal antibody (M01), clone 3A8.Lane 1: STYK1 transfected lysate(47.5 KDa).Lane 2: ...read more
Western Blot: STYK1 Antibody (3A8) [H00055359-M01] - Analysis of STYK1 over-expressed 293 cell line, cotransfected with STYK1 Validated Chimera RNAi ( Cat # H00055359-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: STYK1 Antibody (3A8) [H00055359-M01] - Detection limit for recombinant GST tagged STYK1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
3A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STYK1 Antibody (3A8) Summary

Immunogen
STYK1 (NP_060893, 50 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
Specificity
STYK1 - serine/threonine/tyrosine kinase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STYK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STYK1 Antibody (3A8)

  • DKFZp761P1010
  • EC 2.7.10.2
  • NOK
  • NOKProtein PK-unique
  • serine/threonine/tyrosine kinase 1Novel oncogene with kinase domain
  • STYK1
  • SuRTK106
  • tyrosine-protein kinase STYK1

Background

Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83716
Species: Hu
Applications: IHC, IHC-P
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00002023-M01
Species: Hu, Fe
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22194
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-15016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66840
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00055359-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA

Publications for STYK1 Antibody (H00055359-M01) (0)

There are no publications for STYK1 Antibody (H00055359-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STYK1 Antibody (H00055359-M01) (0)

There are no reviews for STYK1 Antibody (H00055359-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STYK1 Antibody (H00055359-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STYK1 Products

Bioinformatics Tool for STYK1 Antibody (H00055359-M01)

Discover related pathways, diseases and genes to STYK1 Antibody (H00055359-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STYK1 Antibody (H00055359-M01)

Discover more about diseases related to STYK1 Antibody (H00055359-M01).
 

Pathways for STYK1 Antibody (H00055359-M01)

View related products by pathway.

PTMs for STYK1 Antibody (H00055359-M01)

Learn more about PTMs related to STYK1 Antibody (H00055359-M01).
 

Research Areas for STYK1 Antibody (H00055359-M01)

Find related products by research area.

Blogs on STYK1

There are no specific blogs for STYK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STYK1 Antibody (3A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol STYK1
Entrez
Uniprot