STRC Antibody

Images

 
Western Blot: STRC Antibody [NBP1-84261] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: STRC Antibody [NBP1-84261] - Staining of human bone marrow shows strong cytoplasmic positivity in Megakaryocytes.
Western Blot: STRC Antibody [NBP1-84261] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STRC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ACHDQFPDEFLDAICSNLSFSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIFWGCFLENETLWAERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCAND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STRC Protein (NBP1-84261PEP)
Publications
Read Publication using NBP1-84261.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23593218)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STRC Antibody

  • DFNB16
  • MGC156147
  • stereocilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84363
Species: Hu
Applications: IHC, IHC-P
38160002
Species: Hu
Applications: WB, ELISA
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5249
Species: Hu
Applications: WB
H00064699-M01
Species: Hu
Applications: WB, ELISA
NB600-230
Species: Hu
Applications: WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84261
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for STRC Antibody (NBP1-84261)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for STRC Antibody (NBP1-84261) (0)

There are no reviews for STRC Antibody (NBP1-84261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STRC Antibody (NBP1-84261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STRC Products

STRC NBP1-84261

Bioinformatics Tool for STRC Antibody (NBP1-84261)

Discover related pathways, diseases and genes to STRC Antibody (NBP1-84261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRC Antibody (NBP1-84261)

Discover more about diseases related to STRC Antibody (NBP1-84261).
 

Pathways for STRC Antibody (NBP1-84261)

View related products by pathway.

PTMs for STRC Antibody (NBP1-84261)

Learn more about PTMs related to STRC Antibody (NBP1-84261).

Blogs on STRC

There are no specific blogs for STRC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STRC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STRC