STRAP Antibody


Western Blot: STRAP Antibody [NBP1-52949] - Titration: 0.5ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human placenta.
Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

STRAP Antibody Summary

Synthetic peptides corresponding to STRAP(serine/threonine kinase receptor associated protein) The peptide sequence was selected from the N terminal of STRAP (NP_009109). Peptide sequence HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.5 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
STRAP Lysate (NBP2-65867)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STRAP Antibody

  • MAP activator with WD repeats
  • MAWDpt-wd
  • serine/threonine kinase receptor associated protein
  • serine-threonine kinase receptor-associated protein
  • UNR-interacting protein
  • WD-40 repeat protein PT-WD


The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STRAP Antibody (NBP1-52949) (0)

There are no publications for STRAP Antibody (NBP1-52949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRAP Antibody (NBP1-52949) (0)

There are no reviews for STRAP Antibody (NBP1-52949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STRAP Antibody (NBP1-52949). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy an antibody for STRAP (serine-threonine receptor associated protein) and was wondering if you had published references related to the use of your STRAP antibodies. My application would be for Western blot.
    • Unfortunately, we do not have any published references related to the use of our STRAP antibodies yet. The antibodies were tested and validated and the images published on our website are in house images. If you would like me to help you choose an antibody that would be the best choice for your purposes please let me know what species you are working with. I also wanted to mention our 100% <a href="" target="_self">Novus Guarantee</a> to you. We guarantee that the antibody you will use will work in species and application we have validated it in. If you experience any troubles, we will be happy to troubleshoot with you. However, should we fail to resolve your problems we will refund your purchase or replace the antibody with a more appropriate substitute.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional STRAP Products

Bioinformatics Tool for STRAP Antibody (NBP1-52949)

Discover related pathways, diseases and genes to STRAP Antibody (NBP1-52949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRAP Antibody (NBP1-52949)

Discover more about diseases related to STRAP Antibody (NBP1-52949).

Pathways for STRAP Antibody (NBP1-52949)

View related products by pathway.

PTMs for STRAP Antibody (NBP1-52949)

Learn more about PTMs related to STRAP Antibody (NBP1-52949).

Blogs on STRAP

There are no specific blogs for STRAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STRAP Antibody and receive a gift card or discount.


Gene Symbol STRAP