STRA13 Antibody - BSA Free

Western Blot: STRA13 Antibody [NBP2-93570] - Analysis of extracts of H460 cells, using STRA13 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STRA13 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2). MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CENPX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STRA13 Antibody - BSA Free

• BHLHE40
• CENPX
• CENP-X
• DEC1
• FAAP10
• FANCM-interacting histone fold protein 2
• Fanconi anemia-associated polypeptide of 10 kDa
• HLHB2
• MGC14480
• MHF2centromere protein X
• Retinoic acid-inducible gene D9 protein homolog
• stimulated by retinoic acid 13 homolog (mouse)
• stimulated by retinoic acid 13
• Stimulated by retinoic acid gene 13 protein homolog

Background

STRA13 is a component of the CENPS complex, essential for the stable assembly of the outer kinetchore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CENPX