STK4 Antibody (4F4) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related STK4 Primary Antibodies

Order Details


    • Catalog Number
      H00006789-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STK4 Antibody (4F4) [PE] Summary

Immunogen
STK4 (NP_006273 391 a.a. - 485 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Specificity
STK4 - serine/threonine kinase 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK4 Antibody (4F4) [PE]

  • EC 2.7.11
  • EC 2.7.11.1
  • kinase responsive to stress 2
  • KRS2KRS2))
  • Mammalian STE20-like protein kinase 1
  • mammalian sterile 20-like 1
  • MST-1
  • MST1DKFZp686A2068
  • serine/threonine kinase 4
  • serine/threonine-protein kinase 4
  • Serine/threonine-protein kinase Krs-2
  • STE20-like kinase MST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF5066
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86860
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for STK4 Antibody (H00006789-M02PE) (0)

There are no publications for STK4 Antibody (H00006789-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK4 Antibody (H00006789-M02PE) (0)

There are no reviews for STK4 Antibody (H00006789-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STK4 Antibody (H00006789-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK4 Products

Bioinformatics Tool for STK4 Antibody (H00006789-M02PE)

Discover related pathways, diseases and genes to STK4 Antibody (H00006789-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK4 Antibody (H00006789-M02PE)

Discover more about diseases related to STK4 Antibody (H00006789-M02PE).
 

Pathways for STK4 Antibody (H00006789-M02PE)

View related products by pathway.

PTMs for STK4 Antibody (H00006789-M02PE)

Learn more about PTMs related to STK4 Antibody (H00006789-M02PE).
 

Research Areas for STK4 Antibody (H00006789-M02PE)

Find related products by research area.

Blogs on STK4

There are no specific blogs for STK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK4 Antibody (4F4) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol STK4