STI1 Antibody


Western Blot: STI1 Antibody [NBP1-57836] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Product Discontinued
View other related STI1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STI1 Antibody Summary

Synthetic peptides corresponding to STIP1(stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)) The peptide sequence was selected from the N terminal of STIP1. Peptide sequence ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STIP1 and was validated on Western blot.
Positive Control
STI1 Lysate (NBP2-66328)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STI1 Antibody

  • HOP
  • Hsc70/Hsp90-organizing protein
  • Hsp70/Hsp90-organizing protein
  • IEF-SSP-3521
  • NY-REN-11 antigen
  • NY-REN-11
  • Renal carcinoma antigen NY-REN-11
  • STI1
  • STI1L
  • STI1P60
  • STIP1
  • stress-induced-phosphoprotein 1
  • Transformation-sensitive protein IEF SSP 3521


STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for STI1 Antibody (NBP1-57836) (0)

There are no publications for STI1 Antibody (NBP1-57836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STI1 Antibody (NBP1-57836) (0)

There are no reviews for STI1 Antibody (NBP1-57836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STI1 Antibody (NBP1-57836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional STI1 Products

Bioinformatics Tool for STI1 Antibody (NBP1-57836)

Discover related pathways, diseases and genes to STI1 Antibody (NBP1-57836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STI1 Antibody (NBP1-57836)

Discover more about diseases related to STI1 Antibody (NBP1-57836).

Pathways for STI1 Antibody (NBP1-57836)

View related products by pathway.

PTMs for STI1 Antibody (NBP1-57836)

Learn more about PTMs related to STI1 Antibody (NBP1-57836).

Research Areas for STI1 Antibody (NBP1-57836)

Find related products by research area.

Blogs on STI1.

Chaperone Mediated Autophagy (CMA) does it all!
By Christina Towers, PhD. The degradation of cellular proteins is a critical step of both regulation and quality control and results in the turn over and recycling of critical amino acids. The two main mechanisms o...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STI1 Antibody and receive a gift card or discount.


Gene Symbol STIP1