Recombinant Human STEP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STEP Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 388 - 486 of Human PTPN5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG

Protein/Peptide Type
Partial Recombinant Protein
Gene
PTPN5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STEP Protein

  • EC 3.1.3.48
  • FLJ14427
  • Neural-specific protein-tyrosine phosphatase
  • protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
  • protein-tyrosine phosphatase striatum-enriched
  • STEPPTPSTEP
  • Striatum-enriched protein-tyrosine phosphatase
  • tyrosine-protein phosphatase non-receptor type 5

Background

PTPN5 - protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84912
Species: Hu
Applications: IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB7475
Species: Hu, Rt
Applications: WB
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF

Publications for STEP Partial Recombinant Protein (H00084867-Q01) (0)

There are no publications for STEP Partial Recombinant Protein (H00084867-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEP Partial Recombinant Protein (H00084867-Q01) (0)

There are no reviews for STEP Partial Recombinant Protein (H00084867-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STEP Partial Recombinant Protein (H00084867-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STEP Products

Bioinformatics Tool for STEP Partial Recombinant Protein (H00084867-Q01)

Discover related pathways, diseases and genes to STEP Partial Recombinant Protein (H00084867-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEP Partial Recombinant Protein (H00084867-Q01)

Discover more about diseases related to STEP Partial Recombinant Protein (H00084867-Q01).
 

Pathways for STEP Partial Recombinant Protein (H00084867-Q01)

View related products by pathway.

PTMs for STEP Partial Recombinant Protein (H00084867-Q01)

Learn more about PTMs related to STEP Partial Recombinant Protein (H00084867-Q01).
 

Research Areas for STEP Partial Recombinant Protein (H00084867-Q01)

Find related products by research area.

Blogs on STEP

There are no specific blogs for STEP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STEP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN5