STAT6 Antibody (4G7) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
STAT6 (NP_003144 694 a.a. - 801 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD |
| Specificity |
Reacts with signal transducer and activator of transcription 6, interleukin-4 induced. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
STAT6 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Antibody reactivity against cell lysate in WB and recombinant protein in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for STAT6 Antibody (4G7)
Background
Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.
References
1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17
2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Publications for STAT6 Antibody (H00006778-M09) (0)
There are no publications for STAT6 Antibody (H00006778-M09).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STAT6 Antibody (H00006778-M09) (0)
There are no reviews for STAT6 Antibody (H00006778-M09).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STAT6 Antibody (H00006778-M09) (0)