STAT3 Antibody (4D6) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related STAT3 Primary Antibodies

Order Details


    • Catalog Number
      H00006774-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STAT3 Antibody (4D6) [PerCP] Summary

Immunogen
STAT3 (NP_003141 670 a.a. - 769 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Specificity
STAT3 - signal transducer and activator of transcription 3 (acute-phase response factor)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAT3 Antibody (4D6) [PerCP]

  • Acute-phase response factor
  • APRFMGC16063
  • DNA-binding protein APRF
  • FLJ20882
  • HIES
  • signal transducer and activator of transcription 3 (acute-phase responsefactor)
  • signal transducer and activator of transcription 3
  • STAT3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for STAT3 Antibody (H00006774-M02PCP) (0)

There are no publications for STAT3 Antibody (H00006774-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT3 Antibody (H00006774-M02PCP) (0)

There are no reviews for STAT3 Antibody (H00006774-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT3 Antibody (H00006774-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT3 Products

Bioinformatics Tool for STAT3 Antibody (H00006774-M02PCP)

Discover related pathways, diseases and genes to STAT3 Antibody (H00006774-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT3 Antibody (H00006774-M02PCP)

Discover more about diseases related to STAT3 Antibody (H00006774-M02PCP).
 

Pathways for STAT3 Antibody (H00006774-M02PCP)

View related products by pathway.

PTMs for STAT3 Antibody (H00006774-M02PCP)

Learn more about PTMs related to STAT3 Antibody (H00006774-M02PCP).
 

Research Areas for STAT3 Antibody (H00006774-M02PCP)

Find related products by research area.

Blogs on STAT3.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

HLA G - mediating immune tolerance during pregnancy
Human leukocyte antigen G (HLA G) is a major histocompatibility complex (MHC) class I molecule that is primarily expressed in the placenta and is essential for the immune tolerance of the fetus during pregnancy. Unlike many HLA genes, HLA G has re...  Read full blog post.

HIF-1 beta - activating gene transcription in response to hypoxia
Hypoxia-inducible factor 1 (HIF-1) is a heterodimeric transcription factor consisting of alpha and beta subunits. The levels of functional HIF-1 in the cell depends on the level of oxygen allowing cells to respond to hypoxic conditions. HIF-1a is a...  Read full blog post.

TLR4 - A Guardian of Innate Immunity
Toll-like receptor 4 (TLR4) belongs to the family of Toll-like receptors (TLR), and plays a main role in pathogen recognition and innate immunity system activation. The TLR family members are highly conserved proteins that all contain a high degree of...  Read full blog post.

Thymoquinone: A Natural Product with Diverse Therapeutic Potential
Thymoquinone (2-isopropyl-5-methyl-1,4-benzoquinone, or TQ) is derived from the seeds of the black cumin plant Nigella sativa. It has been reported to have a number of beneficial properties including anti-oxidative, anti-inflammatory and anti-tumorige...  Read full blog post.

Survivin Acetylation: Affecting Apoptosis and Cancer
Survivin (BRIC5) is an inhibitor of apoptosis that also promotes cellular adaptation under stressful conditions and helps to regulate cell division. Recently, an antibody study by Dr. H Wang et al. at Brown University [PMID: 20826784] found that Survi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT3 Antibody (4D6) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT3
Entrez