STAT2 Antibody (5G7) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related STAT2 Primary Antibodies

Order Details


    • Catalog Number
      H00006773-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STAT2 Antibody (5G7) [DyLight 680] Summary

Immunogen
STAT2 (AAH51284 742 a.a. - 851 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF
Specificity
STAT2 (5G7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAT2 Antibody (5G7) [DyLight 680]

  • interferon alpha induced transcriptional activator
  • ISGF-3
  • MGC59816
  • P113
  • signal transducer and activator of transcription 2
  • signal transducer and activator of transcription 2, 113kD
  • signal transducer and activator of transcription 2, 113kDa
  • STAT113
  • STAT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5629
Species: Hu, Mu
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF4715
Species: Mu
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for STAT2 Antibody (H00006773-M01FR) (0)

There are no publications for STAT2 Antibody (H00006773-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT2 Antibody (H00006773-M01FR) (0)

There are no reviews for STAT2 Antibody (H00006773-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT2 Antibody (H00006773-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT2 Products

Bioinformatics Tool for STAT2 Antibody (H00006773-M01FR)

Discover related pathways, diseases and genes to STAT2 Antibody (H00006773-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT2 Antibody (H00006773-M01FR)

Discover more about diseases related to STAT2 Antibody (H00006773-M01FR).
 

Pathways for STAT2 Antibody (H00006773-M01FR)

View related products by pathway.

PTMs for STAT2 Antibody (H00006773-M01FR)

Learn more about PTMs related to STAT2 Antibody (H00006773-M01FR).
 

Research Areas for STAT2 Antibody (H00006773-M01FR)

Find related products by research area.

Blogs on STAT2

There are no specific blogs for STAT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT2 Antibody (5G7) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT2
Entrez