STAT1 Antibody (1A8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related STAT1 Primary Antibodies

Order Details


    • Catalog Number
      H00006772-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STAT1 Antibody (1A8) [DyLight 488] Summary

Immunogen
STAT1 (AAH02704 613 a.a. - 712 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Specificity
STAT1 - signal transducer and activator of transcription 1, 91kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAT1 Antibody (1A8) [DyLight 488]

  • CANDF7
  • DKFZp686B04100
  • ISGF-3
  • ISGF-3,91kD
  • signal transducer and activator of transcription 1, 91kDa
  • signal transducer and activator of transcription-1
  • STAT1
  • STAT91

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF2988
Species: Mu, Rt
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF4715
Species: Mu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB

Publications for STAT1 Antibody (H00006772-M01G) (0)

There are no publications for STAT1 Antibody (H00006772-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT1 Antibody (H00006772-M01G) (0)

There are no reviews for STAT1 Antibody (H00006772-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT1 Antibody (H00006772-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT1 Products

Bioinformatics Tool for STAT1 Antibody (H00006772-M01G)

Discover related pathways, diseases and genes to STAT1 Antibody (H00006772-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT1 Antibody (H00006772-M01G)

Discover more about diseases related to STAT1 Antibody (H00006772-M01G).
 

Pathways for STAT1 Antibody (H00006772-M01G)

View related products by pathway.

PTMs for STAT1 Antibody (H00006772-M01G)

Learn more about PTMs related to STAT1 Antibody (H00006772-M01G).
 

Research Areas for STAT1 Antibody (H00006772-M01G)

Find related products by research area.

Blogs on STAT1.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT1 Antibody (1A8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT1
Entrez