Recombinant Human STARD4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STARD4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 205 of Human STARD4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STARD4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STARD4 Protein

  • StARD4
  • StAR-related lipid transfer (START) domain containing 4
  • stAR-related lipid transfer protein 4
  • START domain containing 4 sterol-regulated
  • START domain-containing protein 4
  • sterol regulated

Background

Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-05592
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for STARD4 Recombinant Protein (H00134429-P01) (0)

There are no publications for STARD4 Recombinant Protein (H00134429-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD4 Recombinant Protein (H00134429-P01) (0)

There are no reviews for STARD4 Recombinant Protein (H00134429-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD4 Recombinant Protein (H00134429-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD4 Products

Bioinformatics Tool for STARD4 Recombinant Protein (H00134429-P01)

Discover related pathways, diseases and genes to STARD4 Recombinant Protein (H00134429-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD4 Recombinant Protein (H00134429-P01)

Discover more about diseases related to STARD4 Recombinant Protein (H00134429-P01).
 

Pathways for STARD4 Recombinant Protein (H00134429-P01)

View related products by pathway.

PTMs for STARD4 Recombinant Protein (H00134429-P01)

Learn more about PTMs related to STARD4 Recombinant Protein (H00134429-P01).

Blogs on STARD4

There are no specific blogs for STARD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
STARD4 Antibody
NBP2-30538

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STARD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD4