STAMBPL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STAMBPL1 Antibody [NBP1-89135] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: STAMBPL1 Antibody [NBP1-89135] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAMBPL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAMBPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
STAMBPL1 Protein (NBP1-89135PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAMBPL1 Antibody

  • ALMalpha
  • AMSH-FP
  • AMSHLP
  • AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein
  • associated molecule with the SH3 domain of STAM (AMSH) like protein
  • bA399O19.2
  • EC 3.1.2.15
  • EC 3.4.19.-
  • FLJ31524
  • KIAA1373AMSH-like protease
  • STAM binding protein-like 1
  • STAM-binding protein-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5650
Species: Hu
Applications: WB, IHC
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-89135
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STAMBPL1 Antibody (NBP1-89135) (0)

There are no publications for STAMBPL1 Antibody (NBP1-89135).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAMBPL1 Antibody (NBP1-89135) (0)

There are no reviews for STAMBPL1 Antibody (NBP1-89135). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAMBPL1 Antibody (NBP1-89135) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAMBPL1 Products

Bioinformatics Tool for STAMBPL1 Antibody (NBP1-89135)

Discover related pathways, diseases and genes to STAMBPL1 Antibody (NBP1-89135). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAMBPL1 Antibody (NBP1-89135)

Discover more about diseases related to STAMBPL1 Antibody (NBP1-89135).
 

Pathways for STAMBPL1 Antibody (NBP1-89135)

View related products by pathway.

PTMs for STAMBPL1 Antibody (NBP1-89135)

Learn more about PTMs related to STAMBPL1 Antibody (NBP1-89135).

Blogs on STAMBPL1

There are no specific blogs for STAMBPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAMBPL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAMBPL1
Entrez
Uniprot