STAC2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STAC2 Antibody [NBP1-89392] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: STAC2 Antibody [NBP1-89392] - Staining of human prostate shows distinct membranous and cytoplasmic positivity.

Product Details

Summary
Product Discontinued
View other related STAC2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89392
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

STAC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAC2 Antibody

  • 24b2/STAC2
  • MGC129694
  • SH3 and cysteine rich domain 2,24b2
  • SH3 and cysteine-rich domain-containing protein 2
  • Src homology 3 and cysteine-rich domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20498
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-89392
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for STAC2 Antibody (NBP1-89392) (0)

There are no publications for STAC2 Antibody (NBP1-89392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAC2 Antibody (NBP1-89392) (0)

There are no reviews for STAC2 Antibody (NBP1-89392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STAC2 Antibody (NBP1-89392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAC2 Products

STAC2 NBP1-89392

Bioinformatics Tool for STAC2 Antibody (NBP1-89392)

Discover related pathways, diseases and genes to STAC2 Antibody (NBP1-89392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on STAC2

There are no specific blogs for STAC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAC2