Recombinant Human ST6 Sialyltransferase 6/ST6GALNAC6 Protein

Order Details


    • Catalog Number
      H00030815-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ST6 Sialyltransferase 6/ST6GALNAC6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human ST6GALNAC6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ST6GALNAC6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ST6 Sialyltransferase 6/ST6GALNAC6 Protein

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  • CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI
  • EC 2.4.99
  • EC 2.4.99.-
  • EC 2.4.99.7
  • GalNAc alpha-2,6-sialyltransferase VI
  • hST6GalNAc VI
  • RP11-203J24.3
  • Sialyltransferase 7F
  • sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F
  • SIAT7F
  • SIAT7-F
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6
  • ST6GalNAc VI
  • ST6GALNAC6
  • ST6GALNACVI

Background

ST6GALNAC6( AAH07802, 1 a.a. - 334 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31603
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6715
Species: Hu
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13392
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5924
Species: Hu
Applications: WB, Simple Western
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
6876-GT
Species: Hu

Publications for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01) (0)

There are no publications for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01) (0)

There are no reviews for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST6 Sialyltransferase 6/ST6GALNAC6 Products

Bioinformatics Tool for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01)

Discover related pathways, diseases and genes to ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein (H00030815-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ST6 Sialyltransferase 6/ST6GALNAC6

There are no specific blogs for ST6 Sialyltransferase 6/ST6GALNAC6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ST6 Sialyltransferase 6/ST6GALNAC6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC6
Entrez