ST6 Sialyltransferase 2/ST6GALNAC2 Antibody

Images

 
Western Blot: ST6GALNAC2 Antibody [NBP1-69628] - This Anti-ST6GALNAC2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Order Details


    • Catalog Number
      NBP1-69628
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ST6 Sialyltransferase 2/ST6GALNAC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ST6GALNAC2(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 2) The peptide sequence was selected from the middle region of ST6GALNAC2. Peptide sequence VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSA
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST6GALNAC2 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody

  • (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B
  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
  • EC 2.4.99.-
  • FLJ45660
  • GalNAc alpha-2,6-sialyltransferase II
  • SAITL1
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) B
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase)
  • Sialyltransferase 7B
  • sialyltransferase-like 1
  • SIAT7
  • SIAT7B
  • SIAT7-B
  • SIATL1
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 2
  • ST6GalNAc II
  • ST6GALNAC2
  • ST6GalNAcII
  • ST6GalNAII
  • STHM
  • STHM(alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase

Background

ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-255 AC015802.21 33337-33591 256-1378 BT019972.1 1-1123 1379-2105 AC015802.21 53295-54021

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-69628
Species: Hu
Applications: WB

Publications for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628) (0)

There are no publications for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628) (0)

There are no reviews for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6 Sialyltransferase 2/ST6GALNAC2 Products

Bioinformatics Tool for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628)

Discover related pathways, diseases and genes to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628)

Discover more about diseases related to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628).
 

Pathways for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628)

View related products by pathway.

PTMs for ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628)

Learn more about PTMs related to ST6 Sialyltransferase 2/ST6GALNAC2 Antibody (NBP1-69628).

Blogs on ST6 Sialyltransferase 2/ST6GALNAC2

There are no specific blogs for ST6 Sialyltransferase 2/ST6GALNAC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6 Sialyltransferase 2/ST6GALNAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC2
Entrez
Uniprot