Recombinant Human ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-175 of Human ST6GAL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ST6GAL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Protein

  • Alpha 2,6-ST
  • B-cell antigen CD75
  • beta-galactoside alpha-2,6-sialyltransferase 1
  • CD75
  • CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1
  • EC 2.4.99.1
  • MGC48859
  • sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase)
  • sialyltransferase 1 (beta-galactoside alpha-2,6-sialytransferase)
  • Sialyltransferase 1
  • SIAT1
  • SIAT1Alpha 2,6-ST 1
  • ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
  • ST6Gal I
  • ST6GAL1
  • ST6GalI
  • ST6N

Background

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein, which is normally found in the Golgi but which can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CDw75, and CD76. This protein is a member of glycosyltransferase family 29. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-20491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
H00006480-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01) (0)

There are no publications for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01) (0)

There are no reviews for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Products

Bioinformatics Tool for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01)

Discover related pathways, diseases and genes to ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01)

Discover more about diseases related to ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01).
 

Pathways for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01)

View related products by pathway.

PTMs for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01)

Learn more about PTMs related to ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01).
 

Research Areas for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Recombinant Protein (H00006480-P01)

Find related products by research area.

Blogs on ST6 Gal Sialyltransferase 1/ST6GAL1/CD75

There are no specific blogs for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GAL1
Entrez