Recombinant Human ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Protein

Order Details


    • Catalog Number
      H00006483-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28-127 of Human ST3GAL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ST3GAL2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Protein

  • Alpha 2,3-ST 2
  • Beta-galactoside alpha-2,3-sialyltransferase 2
  • beta-galactoside alpha-2,3-sialytransferase
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • EC 2.4.99.4
  • EC 2.4.99.7
  • Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  • Gal-NAc6S
  • sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
  • Sialyltransferase 4B
  • SIAT4B
  • SIAT4-B
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • ST3GAL2
  • ST3GalA.2
  • ST3GalA.2ST3Gal II
  • ST3GALII

Background

ST3GAL2 - ST3 beta-galactoside alpha-2,3-sialyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31449
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5924
Species: Hu
Applications: WB, Simple Western
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
AF5316
Species: Hu
Applications: WB
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2698
Species: Hu
Applications: WB, IHC, ICC
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00006483-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01) (0)

There are no publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01) (0)

There are no reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Bioinformatics Tool for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01)

Discover related pathways, diseases and genes to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01)

Discover more about diseases related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01).
 

Pathways for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01)

View related products by pathway.

PTMs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01)

Learn more about PTMs related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Partial Recombinant Protein (H00006483-Q01).

Blogs on ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

There are no specific blogs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL2
Entrez