SSX4 Antibody (3E10) [Alexa Fluor® 405] Summary
Immunogen |
SSX4 (NP_005627, 91 a.a. - 188 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE |
Specificity |
SSX4 - synovial sarcoma, X breakpoint 4 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SSX4 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot
- ELISA
- Immunocytochemistry/Immunofluorescence
|
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
IgG purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.
Alternate Names for SSX4 Antibody (3E10) [Alexa Fluor® 405]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
Species: Mu, Rt, Ch, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Ze
Applications: WB, ChIP, ELISA
Publications for SSX4 Antibody (H00006759-M02AF405) (0)
There are no publications for SSX4 Antibody (H00006759-M02AF405).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SSX4 Antibody (H00006759-M02AF405) (0)
There are no reviews for SSX4 Antibody (H00006759-M02AF405).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SSX4 Antibody (H00006759-M02AF405) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional SSX4 Products
Bioinformatics Tool for SSX4 Antibody (H00006759-M02AF405)
Discover related pathways, diseases and genes to SSX4 Antibody (H00006759-M02AF405). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SSX4 Antibody (H00006759-M02AF405)
Discover more about diseases related to SSX4 Antibody (H00006759-M02AF405).
| | Pathways for SSX4 Antibody (H00006759-M02AF405)
View related products by pathway.
|
PTMs for SSX4 Antibody (H00006759-M02AF405)
Learn more about PTMs related to SSX4 Antibody (H00006759-M02AF405).
| | Research Areas for SSX4 Antibody (H00006759-M02AF405)
Find related products by research area.
|
Blogs on SSX4