Recombinant Human SS18 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SS18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-418 of Human SS18 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SS18

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SS18 Protein

  • MGC116875
  • Protein SYT
  • SSXTsynovial sarcoma, translocated to X chromosome
  • Synovial sarcoma translocated to X chromosome protein
  • synovial sarcoma translocation, chromosome 18
  • SYTprotein SSXT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-00614
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
H00006759-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
232-FA/CF
Species: Hu
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SS18 Recombinant Protein (H00006760-P01) (0)

There are no publications for SS18 Recombinant Protein (H00006760-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SS18 Recombinant Protein (H00006760-P01) (0)

There are no reviews for SS18 Recombinant Protein (H00006760-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SS18 Recombinant Protein (H00006760-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SS18 Products

Bioinformatics Tool for SS18 Recombinant Protein (H00006760-P01)

Discover related pathways, diseases and genes to SS18 Recombinant Protein (H00006760-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SS18 Recombinant Protein (H00006760-P01)

Discover more about diseases related to SS18 Recombinant Protein (H00006760-P01).
 

Pathways for SS18 Recombinant Protein (H00006760-P01)

View related products by pathway.

PTMs for SS18 Recombinant Protein (H00006760-P01)

Learn more about PTMs related to SS18 Recombinant Protein (H00006760-P01).
 

Research Areas for SS18 Recombinant Protein (H00006760-P01)

Find related products by research area.

Blogs on SS18

There are no specific blogs for SS18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SS18 Antibody
H00006760-B01P
Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SS18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SS18