SRP68 Antibody (3A3) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related SRP68 Primary Antibodies

Order Details


    • Catalog Number
      H00006730-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SRP68 Antibody (3A3) [PE] Summary

Immunogen
SRP68 (NP_055045.2, 531 a.a. - 627 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS
Specificity
SRP68 - signal recognition particle 68kDa (3A3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRP68
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRP68 Antibody (3A3) [PE]

  • signal recognition particle 68 kDa protein
  • signal recognition particle 68kD
  • signal recognition particle 68kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89498
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89507
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61107
Species: Hu
Applications: WB, IP
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-57100
Species: Hu
Applications: ICC/IF
H00006192-P01
Species: Hu
NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
H00006730-M03PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SRP68 Antibody (H00006730-M03PE) (0)

There are no publications for SRP68 Antibody (H00006730-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRP68 Antibody (H00006730-M03PE) (0)

There are no reviews for SRP68 Antibody (H00006730-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SRP68 Antibody (H00006730-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRP68 Products

Bioinformatics Tool for SRP68 Antibody (H00006730-M03PE)

Discover related pathways, diseases and genes to SRP68 Antibody (H00006730-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP68 Antibody (H00006730-M03PE)

Discover more about diseases related to SRP68 Antibody (H00006730-M03PE).
 

Pathways for SRP68 Antibody (H00006730-M03PE)

View related products by pathway.

PTMs for SRP68 Antibody (H00006730-M03PE)

Learn more about PTMs related to SRP68 Antibody (H00006730-M03PE).

Blogs on SRP68

There are no specific blogs for SRP68, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRP68 Antibody (3A3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SRP68