SREC-I/SCARF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SREC-I/SCARF1 Antibody [NBP2-57396] - Immunohistochemical staining of human gallbladder shows membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SREC-I/SCARF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SREC-I/SCARF1 Antibody - BSA Free (NBP2-57396) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCARF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SREC-I/SCARF1 Recombinant Protein Antigen (NBP2-57396PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SREC-I/SCARF1 Antibody - BSA Free

• Acetyl LDL receptor
• KIAA0149endothelial cells scavenger receptor
• MGC47738
• SCARF1
• scavenger receptor class F, member 1
• Scavenger receptor expressed by endothelial cells 1
• SREC1
• SRECI
• SREC-I
• SRECscavenger receptor expressed by endothelial cells
• SR-F1

Background

SCARF1 is recognised by this antibody is a scavenger receptor that is expressed in endothelial cells and mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). Transcription factors ZNF444/EZF-2 and SP1 are found to be responsible for the regulation of this gene. Five alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCARF1