SREBP1 Antibody (4B10)

Images

 
Western Blot: SREBP1 Antibody (4B10) [H00006720-M01] - SREBF1 monoclonal antibody (M01), clone 4B10. Analysis of SREBF1 expression in HeLa.
Western Blot: SREBP1 Antibody (4B10) [H00006720-M01] - SREBF1 monoclonal antibody (M01), clone 4B10 Analysis of SREBF1 expression in HepG2.
Sandwich ELISA: SREBP1 Antibody (4B10) [H00006720-M01] - Detection limit for recombinant GST tagged SREBF1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SREBP1 Antibody (4B10) Summary

Immunogen
SREBF1 (AAH57388 801 a.a. - 900 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Localization
Cell Membrane, Endoplasmic reticulum, Golgi Apparatus and Nuclear. Multi-pass membrane protein. Moves from the endoplasmic reticulum to the Golgi in the absence of sterols.
Specificity
SREBF1 - sterol regulatory element binding transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SREBF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SREBP1 Antibody (4B10)

  • BHLHD1
  • Class D basic helix-loop-helix protein 1
  • SREBP 1c
  • SREBP-1
  • SREBP1bHLHd1SREBP-1c
  • sterol regulatory element binding protein-1
  • sterol regulatory element binding transcription factor 1
  • sterol regulatory element-binding protein 1
  • Sterol regulatory element-binding transcription factor 1

Background

This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
AF6898
Species: Hu, Mu, Rt
Applications: WB
AF7550
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
H00006720-M01
Species: Hu
Applications: WB, ELISA

Publications for SREBP1 Antibody (H00006720-M01) (0)

There are no publications for SREBP1 Antibody (H00006720-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREBP1 Antibody (H00006720-M01) (0)

There are no reviews for SREBP1 Antibody (H00006720-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SREBP1 Antibody (H00006720-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SREBP1 Products

Bioinformatics Tool for SREBP1 Antibody (H00006720-M01)

Discover related pathways, diseases and genes to SREBP1 Antibody (H00006720-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SREBP1 Antibody (H00006720-M01)

Discover more about diseases related to SREBP1 Antibody (H00006720-M01).
 

Pathways for SREBP1 Antibody (H00006720-M01)

View related products by pathway.

PTMs for SREBP1 Antibody (H00006720-M01)

Learn more about PTMs related to SREBP1 Antibody (H00006720-M01).
 

Research Areas for SREBP1 Antibody (H00006720-M01)

Find related products by research area.

Blogs on SREBP1.

SREBP2 - regulating cholesterol homeostasis and lipid metabolism
Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SREBP1 Antibody (4B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SREBF1
Entrez
OMIM
Uniprot