SRD5A1 Antibody

Images

 
Western Blot: SRD5A1 Antibody [NBP2-88363] - Host: Rabbit. Target Name: SRD5A1. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRD5A1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SRD5A1. Peptide sequence: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SRD5A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRD5A1 Antibody

  • 3-oxo-5-alpha-steroid 4-dehydrogenase 1
  • EC 1.3.1.22
  • EC 1.3.99.5,3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
  • S5AR 1
  • SR type 1
  • SRD5A1
  • Steroid 5-alpha-reductase 1,5-alpha reductase
  • steroid 5-alpha-reductase type I
  • steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 1)

Background

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). There are 2 isoforms of the enzyme: SRD5A1 and SRD5A2 (MIM 607306).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-46510
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
AF4036
Species: Hu
Applications: Simple Western, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
7678-DH
Species: Hu
Applications: EnzAct
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP2-79775
Species: Hu
Applications: IHC, IHC-P, PA, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SRD5A1 Antibody (NBP2-88363) (0)

There are no publications for SRD5A1 Antibody (NBP2-88363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRD5A1 Antibody (NBP2-88363) (0)

There are no reviews for SRD5A1 Antibody (NBP2-88363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRD5A1 Antibody (NBP2-88363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRD5A1 Products

Bioinformatics Tool for SRD5A1 Antibody (NBP2-88363)

Discover related pathways, diseases and genes to SRD5A1 Antibody (NBP2-88363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRD5A1 Antibody (NBP2-88363)

Discover more about diseases related to SRD5A1 Antibody (NBP2-88363).
 

Pathways for SRD5A1 Antibody (NBP2-88363)

View related products by pathway.

PTMs for SRD5A1 Antibody (NBP2-88363)

Learn more about PTMs related to SRD5A1 Antibody (NBP2-88363).
 

Research Areas for SRD5A1 Antibody (NBP2-88363)

Find related products by research area.

Blogs on SRD5A1

There are no specific blogs for SRD5A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRD5A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRD5A1