SR140 Antibody

Images

 
Western Blot: SR140 Antibody [NBP1-92444] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SR140 Antibody [NBP1-92444] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SR140 Antibody [NBP1-92444] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SR140 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL
Specificity
Specificity of human, mouse, rat SR140 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2SURP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SR140 Protein (NBP1-92444PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SR140 Antibody

  • 140 kDa Ser/Arg-rich domain protein
  • FSAPa
  • KIAA0332
  • SR140
  • U2 snRNP-associated SURP domain containing
  • U2 snRNP-associated SURP motif-containing protein
  • U2-associated protein SR140
  • U2-Associated SR140 Protein
  • U2SURP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB300-102
Species: Mu, Rt, Gp, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00010921-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NB600-922
Species: Ch
Applications: WB, ELISA, IHC, IHC-P, IP, Single-Cell Western
NBP2-14845
Species: Hu
Applications: WB, IHC, IHC-P
H00001678-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF6387
Species: Hu
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC

Publications for SR140 Antibody (NBP1-92444) (0)

There are no publications for SR140 Antibody (NBP1-92444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR140 Antibody (NBP1-92444) (0)

There are no reviews for SR140 Antibody (NBP1-92444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SR140 Antibody (NBP1-92444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SR140 Products

Array NBP1-92444

Bioinformatics Tool for SR140 Antibody (NBP1-92444)

Discover related pathways, diseases and genes to SR140 Antibody (NBP1-92444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SR140

There are no specific blogs for SR140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR140 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol U2SURP