SR1 Antibody (1E12.)

Images

 
Western Blot: SR1 Antibody (1E12) [H00006717-M01] - SRI monoclonal antibody (M01), clone 1E12. Analysis of SRI expression in Raw 264.7.
Western Blot: SR1 Antibody (1E12) [H00006717-M01] - SRI monoclonal antibody (M01), clone 1E12 Analysis of SRI expression in HeLa.
Western Blot: SR1 Antibody (1E12) [H00006717-M01] - SRI monoclonal antibody (M01), clone 1E12. Analysis of SRI expression in PC-12.
Western Blot: SR1 Antibody (1E12) [H00006717-M01] - SRI monoclonal antibody (M01), clone 1E12. Analysis of SRI expression in NIH/3T3.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SR1 Antibody (1E12.) Summary

Immunogen
SRI (AAH11025, 1 a.a. - 198 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Localization
Cytoplasmic
Specificity
SRI - sorcin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRI
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SR1 Antibody (1E12.)

  • calcium binding protein amplified in mutlidrug-resistant cells
  • CP22
  • CP-22
  • FLJ26259,22 kDa protein
  • H_RG167B05.1
  • SCN
  • sorcin
  • V19

Background

Sorcin (SR1) is a Ca2+-binding protein first identified in multidrug-resistant cells. This protein is widely distributed in mammalian tissues, including heart and skeletal muscle. At the subcellular level, sorcin localizes to T-tubule junctions of cardiac SR and co-localizes with brain ryanodine receptors in rat brain caudate-putamen nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
AF3926
Species: Hu, Mu, Rt
Applications: WB
AF6387
Species: Hu
Applications: WB
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-13296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
H00006717-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for SR1 Antibody (H00006717-M01) (0)

There are no publications for SR1 Antibody (H00006717-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR1 Antibody (H00006717-M01) (0)

There are no reviews for SR1 Antibody (H00006717-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR1 Antibody (H00006717-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SR1 Products

Bioinformatics Tool for SR1 Antibody (H00006717-M01)

Discover related pathways, diseases and genes to SR1 Antibody (H00006717-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SR1 Antibody (H00006717-M01)

Discover more about diseases related to SR1 Antibody (H00006717-M01).
 

Pathways for SR1 Antibody (H00006717-M01)

View related products by pathway.

PTMs for SR1 Antibody (H00006717-M01)

Learn more about PTMs related to SR1 Antibody (H00006717-M01).

Blogs on SR1

There are no specific blogs for SR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR1 Antibody (1E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SRI
Entrez
OMIM
Uniprot