Splicing Factor 1 Antibody (2E12.) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Splicing Factor 1 Primary Antibodies

Order Details


    • Catalog Number
      H00007536-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Splicing Factor 1 Antibody (2E12.) [PE] Summary

Immunogen
SF1 (NP_004621, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Specificity
SF1 - splicing factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Splicing Factor 1 Antibody (2E12.) [PE]

  • Mammalian branch point-binding protein
  • mBBP
  • splicing factor 1
  • Transcription factor ZFM1
  • ZFM1BBP
  • Zinc finger gene in MEN1 locus
  • Zinc finger protein 162D11S636
  • ZNF162MBBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
PP-H7431-00
Species: Hu
Applications: WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
AF3075
Species: Hu
Applications: WB, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF475
Species: Mu
Applications: WB, IHC
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007536-M01PE
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Splicing Factor 1 Antibody (H00007536-M01PE) (0)

There are no publications for Splicing Factor 1 Antibody (H00007536-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Splicing Factor 1 Antibody (H00007536-M01PE) (0)

There are no reviews for Splicing Factor 1 Antibody (H00007536-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Splicing Factor 1 Antibody (H00007536-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Splicing Factor 1 Products

Bioinformatics Tool for Splicing Factor 1 Antibody (H00007536-M01PE)

Discover related pathways, diseases and genes to Splicing Factor 1 Antibody (H00007536-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Splicing Factor 1 Antibody (H00007536-M01PE)

Discover more about diseases related to Splicing Factor 1 Antibody (H00007536-M01PE).
 

Pathways for Splicing Factor 1 Antibody (H00007536-M01PE)

View related products by pathway.

PTMs for Splicing Factor 1 Antibody (H00007536-M01PE)

Learn more about PTMs related to Splicing Factor 1 Antibody (H00007536-M01PE).

Blogs on Splicing Factor 1

There are no specific blogs for Splicing Factor 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Splicing Factor 1 Antibody (2E12.) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SF1