SPINK6 Antibody


Western Blot: SPINK6 Antibody [NBP1-68906] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related SPINK6 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SPINK6 Antibody Summary

Synthetic peptides corresponding to SPINK6 (serine peptidase inhibitor, Kazal type 6) The peptide sequence was selected from the middle region of SPINK6 9 (NP_995313). Peptide sequence GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPINK6 Antibody

  • Kazal type 6
  • serine peptidase inhibitor, Kazal type 6


The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Ba
Applications: WB, ELISA
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for SPINK6 Antibody (NBP1-68906) (0)

There are no publications for SPINK6 Antibody (NBP1-68906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK6 Antibody (NBP1-68906) (0)

There are no reviews for SPINK6 Antibody (NBP1-68906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPINK6 Antibody (NBP1-68906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPINK6 Products

SPINK6 NBP1-68906

Bioinformatics Tool for SPINK6 Antibody (NBP1-68906)

Discover related pathways, diseases and genes to SPINK6 Antibody (NBP1-68906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK6 Antibody (NBP1-68906)

Discover more about diseases related to SPINK6 Antibody (NBP1-68906).

Pathways for SPINK6 Antibody (NBP1-68906)

View related products by pathway.

Blogs on SPINK6

There are no specific blogs for SPINK6, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPINK6 Antibody and receive a gift card or discount.


Gene Symbol SPINK6