Recombinant Human Sphingosine Kinase 1/SPHK1 Protein

Images

 

Order Details


    • Catalog Number
      H00008877-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Sphingosine Kinase 1/SPHK1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 261-353 of Human SPHK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFA

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPHK1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sphingosine Kinase 1/SPHK1 Protein

  • EC 2.7.1.91
  • SK1
  • sphingosine kinase 1
  • SPHK1
  • SPHKSK 1
  • SPK 1
  • SPK
  • SPK1

Background

SPHK1 - sphingosine kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57340
Species: Hu
Applications: ICC/IF
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-05680
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC

Publications for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01) (0)

There are no publications for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01) (0)

There are no reviews for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sphingosine Kinase 1/SPHK1 Products

Bioinformatics Tool for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01)

Discover related pathways, diseases and genes to Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01)

Discover more about diseases related to Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01).
 

Pathways for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01)

View related products by pathway.

PTMs for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01)

Learn more about PTMs related to Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01).
 

Research Areas for Sphingosine Kinase 1/SPHK1 Partial Recombinant Protein (H00008877-Q01)

Find related products by research area.

Blogs on Sphingosine Kinase 1/SPHK1

There are no specific blogs for Sphingosine Kinase 1/SPHK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sphingosine Kinase 1/SPHK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPHK1
Entrez