Sphingosine Kinase 1/SPHK1 Antibody

Images

 
Immunohistochemistry-Paraffin: Sphingosine Kinase 1/SPHK1 Antibody [NBP1-87011] - Staining of human appendix shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sphingosine Kinase 1/SPHK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPHK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sphingosine Kinase 1/SPHK1 Protein (NBP1-87011PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sphingosine Kinase 1/SPHK1 Antibody

  • EC 2.7.1.91
  • SK1
  • sphingosine kinase 1
  • SPHK1
  • SPHKSK 1
  • SPK 1
  • SPK
  • SPK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57340
Species: Hu
Applications: ICC/IF
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-05680
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC

Publications for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011) (0)

There are no publications for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011) (0)

There are no reviews for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sphingosine Kinase 1/SPHK1 Products

Bioinformatics Tool for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011)

Discover related pathways, diseases and genes to Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011)

Discover more about diseases related to Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011).
 

Pathways for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011)

View related products by pathway.

PTMs for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011)

Learn more about PTMs related to Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011).
 

Research Areas for Sphingosine Kinase 1/SPHK1 Antibody (NBP1-87011)

Find related products by research area.

Blogs on Sphingosine Kinase 1/SPHK1

There are no specific blogs for Sphingosine Kinase 1/SPHK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sphingosine Kinase 1/SPHK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPHK1
Entrez